Ccl8 (Mouse) Recombinant Protein View larger

Ccl8 (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Ccl8 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Ccl8 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4626
Product name: Ccl8 (Mouse) Recombinant Protein
Product description: Mouse Ccl8 (Q9Z121) recombinant protein expressed in Escherichia coli.
Gene id: 20307
Gene name: Ccl8
Gene alias: 1810063B20Rik|AB023418|HC14|MCP-2|Mcp2|Scya8
Gene description: chemokine (C-C motif) ligand 8
Immunogen sequence/protein sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Protein accession: Q9Z121
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4626-1.jpg
Quality control testing picture note: Human THP-1 cells were allowed to migrate to mouse Ccl8 at (0, 0.1, 1, and 10ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Ccl8 (Mouse) Recombinant Protein now

Add to cart