Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4621 |
Product name: | Shh (Mouse) Recombinant Protein |
Product description: | Mouse Shh (Q15465) recombinant protein expressed in Escherichia coli. |
Gene id: | 20423 |
Gene name: | Shh |
Gene alias: | 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081 |
Gene description: | sonic hedgehog |
Immunogen sequence/protein sequence: | MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Protein accession: | Q15465 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized with 10 mM Na2PO4, pH 7.5. |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Serial dilutions of mouse Shh, starting at 5 ug/mL, were added to with CCL-226 cells in the presence of 1 uM Retinoic Acid. Alkaline phosphatase was measured and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |