Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ccl20 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ccl20 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4620 |
| Product name: | Ccl20 (Mouse) Recombinant Protein |
| Product description: | Mouse Ccl20 (O89093) recombinant protein expressed in Escherichia coli. |
| Gene id: | 20297 |
| Gene name: | Ccl20 |
| Gene alias: | CKb4|LARC|MIP-3A|MIP-3[a]|MIP3A|ST38|Scya20|exodus-1 |
| Gene description: | chemokine (C-C motif) ligand 20 |
| Immunogen sequence/protein sequence: | ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM |
| Protein accession: | O89093 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Human T cells were allowed to migrate to mouse Ccl20 at (0, 5, 20, 100 and 500 ng/mL). After 4 hours, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |