Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4614 |
Product name: | Ccl19 (Mouse) Recombinant Protein |
Product description: | Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli. |
Gene id: | 24047 |
Gene name: | Ccl19 |
Gene alias: | CKb11|ELC|MIP3B|Scya19|exodus-3 |
Gene description: | chemokine (C-C motif) ligand 19 |
Immunogen sequence/protein sequence: | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
Protein accession: | Q548P0 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |