Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ccl7 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ccl7 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4611 |
| Product name: | Ccl7 (Mouse) Recombinant Protein |
| Product description: | Mouse Ccl7 (Q03366.1) recombinant protein expressed in Escherichia coli. |
| Gene id: | 20306 |
| Gene name: | Ccl7 |
| Gene alias: | MCP-3|Scya7|fic|marc|mcp3 |
| Gene description: | chemokine (C-C motif) ligand 7 |
| Immunogen sequence/protein sequence: | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Protein accession: | Q03366.1 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Human THP-1 cells were allowed to migrate to mouse Ccl3 at (0, 0.1, 1, 10, 100 and 1000 ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |