Cxcl10 (Mouse) Recombinant Protein View larger

Cxcl10 (Mouse) Recombinant Protein

P4609_25ug

New product

259,00 € tax excl.

25 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Cxcl10 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Cxcl10 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4609
Product name: Cxcl10 (Mouse) Recombinant Protein
Product description: Mouse Cxcl10 (P17515) recombinant protein expressed in Escherichia coli.
Gene id: 15945
Gene name: Cxcl10
Gene alias: C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1
Gene description: chemokine (C-X-C motif) ligand 10
Immunogen sequence/protein sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Protein accession: P17515
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4609-1.jpg
Quality control testing picture note: Human T cells were allowed to migrate to mouse Cxcl10 at (0, 5, 20, 100 and 500 ng/mL). After 4 hours, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Cxcl10 (Mouse) Recombinant Protein now

Add to cart