Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ntf3 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ntf3 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4601 |
| Product name: | Ntf3 (Mouse) Recombinant Protein |
| Product description: | Mouse Ntf3 (P20181) recombinant protein expressed in Escherichia coli. |
| Gene id: | 18205 |
| Gene name: | Ntf3 |
| Gene alias: | AI316846|AI835689|NT-3|NT3|Ntf-3 |
| Gene description: | neurotrophin 3 |
| Immunogen sequence/protein sequence: | MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT |
| Protein accession: | P20181 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized with 0.02% TFA. |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Lane 1: non-reducing conditions Lane 2: reducing conditions |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |