Fgf9 (Mouse) Recombinant Protein View larger

Fgf9 (Mouse) Recombinant Protein

P4593_10ug

New product

259,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Fgf9 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Fgf9 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4593
Product name: Fgf9 (Mouse) Recombinant Protein
Product description: Mouse Fgf9 (P54130) recombinant protein expressed in Escherichia coli.
Gene id: 14180
Gene name: Fgf9
Gene alias: -
Gene description: fibroblast growth factor 9
Immunogen sequence/protein sequence: MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Protein accession: P54130
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized with 10 mM Na2PO4, 75 mM (NH4)2SO4, pH 7.5.
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4593-1.jpg
Quality control testing picture note: 3T3 cells were cultured with 0 to 100 ng/mL mouse Fgf9. Cell proliferation was measured after 42 hours and the linear portion of the curve was us used to calculate the ED50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Fgf9 (Mouse) Recombinant Protein now

Add to cart