Fgf2 (Mouse) Recombinant Protein View larger

Fgf2 (Mouse) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Fgf2 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Fgf2 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4592
Product name: Fgf2 (Mouse) Recombinant Protein
Product description: Mouse Fgf2 (P15655) recombinant protein expressed in Escherichia coli.
Gene id: 14173
Gene name: Fgf2
Gene alias: Fgf-2|Fgfb|bFGF
Gene description: fibroblast growth factor 2
Immunogen sequence/protein sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Protein accession: P15655
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 5 mM Na2PO4, 50 mM NaCl, pH 7.5.
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4592-1.jpg
Quality control testing picture note: Serial dilutions of mouse Fgf2, starting at 5 ng/mL, were added to NIH 3T3 cells. Cell proliferation was measured after 41 hours and the linear portion of the curve was us used to calculate the ED50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Fgf2 (Mouse) Recombinant Protein now

Add to cart