Ngf (Mouse) Recombinant Protein View larger

Ngf (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Ngf (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Ngf (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4591
Product name: Ngf (Mouse) Recombinant Protein
Product description: Mouse Ngf (Q6LDU8) recombinant protein expressed in Escherichia coli.
Gene id: 18049
Gene name: Ngf
Gene alias: Ngfb
Gene description: nerve growth factor
Immunogen sequence/protein sequence: MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Protein accession: Q6LDU8
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4591-1.jpg
Quality control testing picture note: Serial dilutions of mouse Ngf, starting at 100 ng/mL, were added to TF-1 cells growing in GM-SCF free media. Cell proliferation was measure after 63 hours and the linear portion of the curve was us used to calculate the ED50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Ngf (Mouse) Recombinant Protein now

Add to cart