Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4591 |
Product name: | Ngf (Mouse) Recombinant Protein |
Product description: | Mouse Ngf (Q6LDU8) recombinant protein expressed in Escherichia coli. |
Gene id: | 18049 |
Gene name: | Ngf |
Gene alias: | Ngfb |
Gene description: | nerve growth factor |
Immunogen sequence/protein sequence: | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |
Protein accession: | Q6LDU8 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Serial dilutions of mouse Ngf, starting at 100 ng/mL, were added to TF-1 cells growing in GM-SCF free media. Cell proliferation was measure after 63 hours and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |