Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4590 |
Product name: | Cd40lg (Mouse) Recombinant Protein |
Product description: | Mouse Cd40lg (P27548) recombinant protein expressed in Escherichia coli. |
Gene id: | 21947 |
Gene name: | Cd40lg |
Gene alias: | CD154|Cd40l|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|TRAP|Tnfsf5|gp39 |
Gene description: | CD40 ligand |
Immunogen sequence/protein sequence: | MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL |
Protein accession: | P27548 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized with 10 mM Na2PO4, pH 7.5. |
Storage instruction: | Store at -20°C to -80°C. After reconstitution with 250 uL of sterilized water, store at -20°C to -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Serial dilutions of mouse Cd40lg, starting at 250 ng/mL, were added to human PBMCs. After 39 hours, cell supernatant was collected and human IL-8 was measured via ELISA and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |
Publications: | Soluble CD40 ligand disrupts the blood-brain barrier and exacerbates inflammation in experimental autoimmune encephalomyelitis.Masuda H, Mori M, Umehara K, Furihata T, Uchida T, Uzawa A, Kuwabara S. J Neuroimmunol. 2018 Mar 15;316:117-120. doi: 10.1016/j.jneuroim.2018.01.001. Epub 2018 Jan 3. |