Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4585 |
Product name: | Igf1 (Mouse) Recombinant Protein |
Product description: | Mouse Igf1 (Q8CAR0) recombinant protein expressed in Escherichia coli. |
Gene id: | 16000 |
Gene name: | Igf1 |
Gene alias: | C730016P09Rik|Igf-1|Igf-I |
Gene description: | insulin-like growth factor 1 |
Immunogen sequence/protein sequence: | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
Protein accession: | Q8CAR0 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | FDC-P1 cells were cultured with 0 to 250 ng/mL mouse Igf1. Cell proliferation was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |