Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4575 |
Product name: | TNFRSF1A (Human) Recombinant Protein |
Product description: | Human TNFRSF1A recombinant protein expressed in Escherichia coli. |
Gene id: | 7132 |
Gene name: | TNFRSF1A |
Gene alias: | CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60 |
Gene description: | tumor necrosis factor receptor superfamily, member 1A |
Immunogen sequence/protein sequence: | MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized with 10 mM Na2PO4, pH 7.5. |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | 929 cells were cultured with 1 ng/mL human TNF and 1 ug/mL Actinomycin D, plus serial dilutions of human TNFRSF1A from 0-10 ug/mL. Cell proliferation was measured after 24 hours and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |