GDF15 (D variant) (Human) Recombinant Protein View larger

GDF15 (D variant) (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF15 (D variant) (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about GDF15 (D variant) (Human) Recombinant Protein

Brand: Abnova
Reference: P4571
Product name: GDF15 (D variant) (Human) Recombinant Protein
Product description: Human GDF15 (D variant) (Q99988) recombinant protein expressed in Escherichia coli.
Gene id: 9518
Gene name: GDF15
Gene alias: GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB
Gene description: growth differentiation factor 15
Immunogen sequence/protein sequence: MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Protein accession: Q99988
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with 5 mM acetic acid, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: qc_test-P4571-1.jpg
Quality control testing picture note: Lane 1: non-reducing conditions
Lane 2: reducing conditions
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy GDF15 (D variant) (Human) Recombinant Protein now

Add to cart