IL4 (Human) Recombinant Protein View larger

IL4 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL4 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about IL4 (Human) Recombinant Protein

Brand: Abnova
Reference: P4558
Product name: IL4 (Human) Recombinant Protein
Product description: Human IL4 (P05112) recombinant protein expressed in Escherichia coli.
Gene id: 3565
Gene name: IL4
Gene alias: BCGF-1|BCGF1|BSF1|IL-4|MGC79402
Gene description: interleukin 4
Immunogen sequence/protein sequence: MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Protein accession: P05112
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: note-P4558-1.jpg
Quality control testing picture note: MC-9 cells were cultured with 0 to 2 ng/mL human IL4. Cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy IL4 (Human) Recombinant Protein now

Add to cart