SRR (Human) Recombinant Protein View larger

SRR (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRR (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about SRR (Human) Recombinant Protein

Brand: Abnova
Reference: P4542
Product name: SRR (Human) Recombinant Protein
Product description: Human SRR (NP_068766, 1 a.a. - 340 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 63826
Gene name: SRR
Gene alias: ILV1|ISO1
Gene description: serine racemase
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMGSHMCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Protein accession: NP_068766
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0. (20% glycerol, 1 mM DTT)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 15% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4542-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy SRR (Human) Recombinant Protein now

Add to cart