GPX2 (Human) Recombinant Protein View larger

GPX2 (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPX2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about GPX2 (Human) Recombinant Protein

Brand: Abnova
Reference: P4538
Product name: GPX2 (Human) Recombinant Protein
Product description: Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 2877
Gene name: GPX2
Gene alias: GI-GPx|GPRP|GSHPX-GI|GSHPx-2
Gene description: glutathione peroxidase 2 (gastrointestinal)
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI
Protein accession: NP_002074
Form: Liquid
Concentration: 0.25 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 0.15 M NaCl, pH7.5. (40% glycerol, 1 mM DTT)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 15% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4538-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy GPX2 (Human) Recombinant Protein now

Add to cart