Csf1r (Mouse) Recombinant Protein View larger

Csf1r (Mouse) Recombinant Protein

New product

294,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Csf1r (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesMouse
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about Csf1r (Mouse) Recombinant Protein

Reference: P4534
Product name: Csf1r (Mouse) Recombinant Protein
Product description: Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 12978
Gene name: Csf1r
Gene alias: AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR
Gene description: colony stimulating factor 1 receptor
Genbank accession: NM_001037859
Immunogen sequence/protein sequence: ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD
Protein accession: NP_001032948.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy Csf1r (Mouse) Recombinant Protein now

Add to cart