Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P4512 |
Product name: | Pdgfa (Mouse) Recombinant Protein |
Product description: | Mouse Pdgfa (P20033, 126 amino acids) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 18590 |
Gene name: | Pdgfa |
Gene alias: | - |
Gene description: | platelet derived growth factor, alpha |
Immunogen sequence/protein sequence: | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT |
Protein accession: | P20033 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |