Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4425 |
Product name: | CCL13 (Human) Recombinant Protein |
Product description: | Human CCL13 (Q99616) recombinant protein expressed in Escherichia coli. |
Gene id: | 6357 |
Gene name: | CCL13 |
Gene alias: | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
Gene description: | chemokine (C-C motif) ligand 13 |
Immunogen sequence/protein sequence: | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Protein accession: | Q99616 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Human THP-1 cells were allowed to migrate to human CCL13 at (0, 0.1, 1, 10, 100 and 1000 ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |