IL20 (Human) Recombinant Protein View larger

IL20 (Human) Recombinant Protein

P4411_10ug

New product

259,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL20 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about IL20 (Human) Recombinant Protein

Brand: Abnova
Reference: P4411
Product name: IL20 (Human) Recombinant Protein
Product description: Human IL20 (Q9NYY1) recombinant protein expressed in Escherichia coli.
Gene id: 50604
Gene name: IL20
Gene alias: IL-20|IL10D|MGC96907|ZCYTO10
Gene description: interleukin 20
Immunogen sequence/protein sequence: MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Protein accession: Q9NYY1
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 10 mM sodium citrate, 100 mM NaCl, pH 3.0
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: qc_test-P4411-1.jpg
Quality control testing picture note: Lane 1: non-reducing conditions
Lane 2: reducing conditions
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy IL20 (Human) Recombinant Protein now

Add to cart