IL15 (Human) Recombinant Protein View larger

IL15 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL15 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about IL15 (Human) Recombinant Protein

Brand: Abnova
Reference: P4407
Product name: IL15 (Human) Recombinant Protein
Product description: Human IL15 (P40933) recombinant protein expressed in Escherichia coli.
Gene id: 3600
Gene name: IL15
Gene alias: IL-15|MGC9721
Gene description: interleukin 15
Immunogen sequence/protein sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Protein accession: P40933
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from a 5 mM Tris, pH 8.0
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy IL15 (Human) Recombinant Protein now

Add to cart