Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4386 |
Product name: | FGF2 (Human) Recombinant Protein |
Product description: | Human FGF2 (P09038) recombinant protein expressed in Escherichia coli. |
Gene id: | 2247 |
Gene name: | FGF2 |
Gene alias: | BFGF|FGFB|HBGF-2 |
Gene description: | fibroblast growth factor 2 (basic) |
Immunogen sequence/protein sequence: | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Protein accession: | P09038 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized from 10 mM Na2PO4, pH 8.0 |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Lane 1: reducing conditions Lane 2: non-reducing conditions |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |