Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4383 |
Product name: | FGF22 (Human) Recombinant Protein |
Product description: | Human FGF22 (Q9HCT0) recombinant protein expressed in Escherichia coli. |
Gene id: | 27006 |
Gene name: | FGF22 |
Gene alias: | - |
Gene description: | fibroblast growth factor 22 |
Immunogen sequence/protein sequence: | MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS |
Protein accession: | Q9HCT0 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Reducing conditions |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |