BDNF (Human) Recombinant Protein View larger

BDNF (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BDNF (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about BDNF (Human) Recombinant Protein

Brand: Abnova
Reference: P4375
Product name: BDNF (Human) Recombinant Protein
Product description: Human BDNF (P23560) recombinant protein expressed in Escherichia coli.
Gene id: 627
Gene name: BDNF
Gene alias: MGC34632
Gene description: brain-derived neurotrophic factor
Immunogen sequence/protein sequence: MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Protein accession: P23560
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: No additive
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: qc_test-P4375-1.jpg
Quality control testing picture note: Lane 1: non-reducing conditions
Lane 2: reducing conditions
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy BDNF (Human) Recombinant Protein now

Add to cart