Brand: | Abnova |
Reference: | P4368 |
Product name: | Kitl (Mouse) Recombinant Protein |
Product description: | Mouse Kitl (P20826, 36 a.a. - 189 a.a.) partial recombinant protein expressed in Insect cells. |
Gene id: | 17311 |
Gene name: | Kitl |
Gene alias: | Clo|Con|Gb|Kitlg|Mgf|SCF|SF|SLF|Sl|Steel|contrasted |
Gene description: | kit ligand |
Immunogen sequence/protein sequence: | KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Protein accession: | P20826 |
Form: | Lyophilized |
Preparation method: | Insect cell expression system |
Storage buffer: | Lyophilized from 20 mM Tris, pH 7.5 (5% trehalose) |
Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Insect |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |