Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Kitl (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about Kitl (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4368 |
| Product name: | Kitl (Mouse) Recombinant Protein |
| Product description: | Mouse Kitl (P20826, 36 a.a. - 189 a.a.) partial recombinant protein expressed in Insect cells. |
| Gene id: | 17311 |
| Gene name: | Kitl |
| Gene alias: | Clo|Con|Gb|Kitlg|Mgf|SCF|SF|SLF|Sl|Steel|contrasted |
| Gene description: | kit ligand |
| Immunogen sequence/protein sequence: | KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Protein accession: | P20826 |
| Form: | Lyophilized |
| Preparation method: | Insect cell expression system |
| Storage buffer: | Lyophilized from 20 mM Tris, pH 7.5 (5% trehalose) |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |