Il33 (Mouse) Recombinant Protein View larger

Il33 (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Il33 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Il33 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4362
Product name: Il33 (Mouse) Recombinant Protein
Product description: Mouse Il33 (Q8BVZ5, 109 a.a. - 266 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 77125
Gene name: Il33
Gene alias: 9230117N10Rik|Il-33|Il1f11|NF-HEV
Gene description: interleukin 33
Immunogen sequence/protein sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Protein accession: Q8BVZ5
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from PBS, pH 7.5
Storage instruction: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Il33 (Mouse) Recombinant Protein now

Add to cart