Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100a9 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about S100a9 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4348 |
| Product name: | S100a9 (Mouse) Recombinant Protein |
| Product description: | Mouse S100a9 (NP_033140, 1 a.a. - 113 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 20202 |
| Gene name: | S100a9 |
| Gene alias: | 60B8Ag|AW546964|BEE22|Cagb|GAGB|L1Ag|MRP14|p14 |
| Gene description: | S100 calcium binding protein A9 (calgranulin B) |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK |
| Protein accession: | NP_033140 |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | Inflammation-induced S100A8 activates Id3 and promotes colorectal tumorigenesis.Zhang X, Ai F1, Li X, She X, Li N, Tang A, Qin Z, Ye Q, Tian L, Li G, Shen S, Ma J. Int J Cancer. 2015 Jul 1.[Epub ahead of print] |