SIT1 (Human) Recombinant Protein View larger

SIT1 (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIT1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about SIT1 (Human) Recombinant Protein

Brand: Abnova
Reference: P4317
Product name: SIT1 (Human) Recombinant Protein
Product description: Human SIT1 (NP_055265, 1 a.a. -196 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 27240
Gene name: SIT1
Gene alias: MGC125908|MGC125909|MGC125910|RP11-331F9.5|SIT
Gene description: signaling threshold regulating transmembrane adaptor 1
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
Protein accession: NP_055265
Form: Liquid
Concentration: 0.25 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, pH 8.0. (20% glycerol)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 15% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4317-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy SIT1 (Human) Recombinant Protein now

Add to cart