CRCP (Human) Recombinant Protein View larger

CRCP (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRCP (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about CRCP (Human) Recombinant Protein

Brand: Abnova
Reference: P3945
Product name: CRCP (Human) Recombinant Protein
Product description: Human CRCP (NP_055293, 1 a.a. - 148 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 27297
Gene name: CRCP
Gene alias: CGRP-RCP|MGC111194|RCP|RCP9
Gene description: CGRP receptor component
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Protein accession: NP_055293
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS PAGE.
Quality control testing picture: qc_test-P3945-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CRCP (Human) Recombinant Protein now

Add to cart