Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MRCL3 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about MRCL3 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3932 |
| Product name: | MRCL3 (Human) Recombinant Protein |
| Product description: | Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 10627 |
| Gene name: | MRCL3 |
| Gene alias: | MLCB|MRLC3 |
| Gene description: | myosin regulatory light chain MRCL3 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| Protein accession: | NP_006462 |
| Form: | Liquid |
| Concentration: | 0.25 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |