Brand: | Abnova |
Reference: | P3813 |
Product name: | IL12B (Human) Recombinant Protein |
Product description: | Human IL12B (NP_002178.2, 23 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 3593 |
Gene name: | IL12B |
Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
Immunogen sequence/protein sequence: | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Protein accession: | NP_002178.2 |
Form: | Liquid |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In PBS (50% glycerol) |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 10% SDS-PAGE Result |
Quality control testing picture: |  |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |