HGF (Human) Recombinant Protein View larger

HGF (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGF (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about HGF (Human) Recombinant Protein

Brand: Abnova
Reference: P3806
Product name: HGF (Human) Recombinant Protein
Product description: Human HGF (NP_000592.3, 495 a.a. - 728 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 3082
Gene name: HGF
Gene alias: F-TCF|HGFB|HPTA|SF
Gene description: hepatocyte growth factor (hepapoietin A; scatter factor)
Immunogen sequence/protein sequence: VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Protein accession: NP_000592.3
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In PBS (50% glycerol)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 10% SDS-PAGE Result
Quality control testing picture: qc_test-P3806-1.jpg
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy HGF (Human) Recombinant Protein now

Add to cart