Brand: | Abnova |
Reference: | P3727 |
Product name: | NANOG (Human) Recombinant Protein |
Product description: | Human NANOG (NP_079141, 1 a.a. - 305 a.a.) full-length recombinant protein expressed in Escherichia coli. |
Gene id: | 79923 |
Gene name: | NANOG |
Gene alias: | - |
Gene description: | Nanog homeobox |
Immunogen sequence/protein sequence: | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV |
Protein accession: | NP_079141 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (0.4 M Urea, 5% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |