PDGFB (Human) Recombinant Protein View larger

PDGFB (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDGFB (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesYeast
ApplicationsFunc,SDS-PAGE

More info about PDGFB (Human) Recombinant Protein

Brand: Abnova
Reference: P3661
Product name: PDGFB (Human) Recombinant Protein
Product description: Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris.
Gene id: 5155
Gene name: PDGFB
Gene alias: FLJ12858|PDGF2|SIS|SSV|c-sis
Gene description: platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Immunogen sequence/protein sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Protein accession: P01127
Form: Lyophilized
Preparation method: Pichia pastoris expression system
Storage buffer: Lyophilized from 0.02 M acetic acid, pH 6.5
Storage instruction: Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Yeast
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy PDGFB (Human) Recombinant Protein now

Add to cart