Brand | Abnova |
Product type | Proteins |
Host species | Hamster |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P3629 |
Product name: | IL12B (Human) Recombinant Protein |
Product description: | Human IL12B (P29460, 23 a.a. - 529 a.a.) partial recombinant protein expressed in CHO cells. |
Gene id: | 3593 |
Gene name: | IL12B |
Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
Immunogen sequence/protein sequence: | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
Protein accession: | P29460 |
Form: | Lyophilized |
Preparation method: | Mammalian cell (CHO) expression system |
Storage buffer: | Lyophilized from PBS, pH 7.5 |
Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Hamster |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |