MSTN (Human) Recombinant Protein View larger

MSTN (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSTN (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about MSTN (Human) Recombinant Protein

Brand: Abnova
Reference: P3612
Product name: MSTN (Human) Recombinant Protein
Product description: Human MSTN (O14793, 267 a.a. - 375 a.a.) partial recombinant protein. expressed in Escherichia coli.
Gene id: 2660
Gene name: MSTN
Gene alias: GDF8
Gene description: myostatin
Immunogen sequence/protein sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Protein accession: O14793
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from Tris, pH 8.0
Storage instruction: Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy MSTN (Human) Recombinant Protein now

Add to cart