Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P3594 |
Product name: | DEFB104A (Human) Recombinant Protein |
Product description: | Human DEFB104A (Q8WTQ1, 23 a.a. - 72 a.a.) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 140596 |
Gene name: | DEFB104A |
Gene alias: | BD-4|DEFB-4|DEFB104|DEFB4|MGC118942|MGC118944|MGC118945|hBD-4 |
Gene description: | defensin, beta 104A |
Immunogen sequence/protein sequence: | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP |
Protein accession: | Q8WTQ1 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized from 100 mM NaCl, 20 mM PB, pH 7.4 |
Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |