DEFB1 (Human) Recombinant Protein View larger

DEFB1 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DEFB1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about DEFB1 (Human) Recombinant Protein

Brand: Abnova
Reference: P3591
Product name: DEFB1 (Human) Recombinant Protein
Product description: Human DEFB1 (P60022, 33 a.a. - 70 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 1672
Gene name: DEFB1
Gene alias: BD1|DEFB-1|DEFB101|HBD1|MGC51822
Gene description: defensin, beta 1
Immunogen sequence/protein sequence: RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Protein accession: P60022
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 100 mM NaCl, 20 mM PB, pH 7.4
Storage instruction: Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy DEFB1 (Human) Recombinant Protein now

Add to cart