DECR1 (Human) Recombinant Protein View larger

DECR1 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DECR1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about DECR1 (Human) Recombinant Protein

Brand: Abnova
Reference: P3575
Product name: DECR1 (Human) Recombinant Protein
Product description: Human DECR1 (NP_001350, 35 a.a. - 335 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Gene id: 1666
Gene name: DECR1
Gene alias: DECR|NADPH|SDR18C1
Gene description: 2,4-dienoyl CoA reductase 1, mitochondrial
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Protein accession: NP_001350
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, pH 8.0 (10% glycerol, 1 mM dithiothreitol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3575-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy DECR1 (Human) Recombinant Protein now

Add to cart