ATOX1 (Human) Recombinant Protein View larger

ATOX1 (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATOX1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about ATOX1 (Human) Recombinant Protein

Brand: Abnova
Reference: P3546
Product name: ATOX1 (Human) Recombinant Protein
Product description: Human ATOX1 (NP_004036, 1 a.a. - 68 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 475
Gene name: ATOX1
Gene alias: ATX1|HAH1|MGC138453|MGC138455
Gene description: ATX1 antioxidant protein 1 homolog (yeast)
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Protein accession: NP_004036
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3546-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy ATOX1 (Human) Recombinant Protein now

Add to cart