CCL28 (Human) Recombinant Protein View larger

CCL28 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL28 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about CCL28 (Human) Recombinant Protein

Brand: Abnova
Reference: P3542
Product name: CCL28 (Human) Recombinant Protein
Product description: Human CCL28 (NP_683513, 23 a.a. - 127 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Gene id: 56477
Gene name: CCL28
Gene alias: CCK1|MEC|MGC71902|SCYA28
Gene description: chemokine (C-C motif) ligand 28
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Protein accession: NP_683513
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 10 mM sodium citrate, pH 3.5 (10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3542-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CCL28 (Human) Recombinant Protein now

Add to cart