Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL17 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about CCL17 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3541 |
| Product name: | CCL17 (Human) Recombinant Protein |
| Product description: | Human CCL17 (NP_002978, 24 a.a. - 94 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 6361 |
| Gene name: | CCL17 |
| Gene alias: | A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC |
| Gene description: | chemokine (C-C motif) ligand 17 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Protein accession: | NP_002978 |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS, pH 7.4 (10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |