Brand: | Abnova |
Reference: | P3536 |
Product name: | XCL1 (Human) Recombinant Protein |
Product description: | Human XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 6375 |
Gene name: | XCL1 |
Gene alias: | ATAC|LPTN|LTN|SCM-1|SCM-1a|SCM1|SCYC1 |
Gene description: | chemokine (C motif) ligand 1 |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Protein accession: | NP_002986 |
Form: | Liquid |
Concentration: | 0.25 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, 0.2 M NaCl, pH 8.0 (2 mM dithiothreitol, 30% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![qc_test-P3536-1.jpg](http://www.abnova.com/qc_test_image/qc_test-P3536-1.jpg) |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |