VAMP5 (Human) Recombinant Protein View larger

VAMP5 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAMP5 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about VAMP5 (Human) Recombinant Protein

Brand: Abnova
Reference: P3530
Product name: VAMP5 (Human) Recombinant Protein
Product description: Human VAMP5 (NP_006625, 1 a.a. - 72 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Gene id: 10791
Gene name: VAMP5
Gene alias: -
Gene description: vesicle-associated membrane protein 5 (myobrevin)
Immunogen sequence/protein sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRIC
Protein accession: NP_006625
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, pH 8.0 (2 mM dithiothreitol, 20% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3530-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy VAMP5 (Human) Recombinant Protein now

Add to cart