DHFR (Human) Recombinant Protein View larger

DHFR (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHFR (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about DHFR (Human) Recombinant Protein

Brand: Abnova
Reference: P3492
Product name: DHFR (Human) Recombinant Protein
Product description: Human DHFR (NP_000782.1, 1 a.a. - 187 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 1719
Gene name: DHFR
Gene alias: -
Gene description: dihydrofolate reductase
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Protein accession: NP_000782.1
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0 (2 mM dithiothreitol, 30% glycerol)
Storage instruction: Store at 4°C. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3492-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy DHFR (Human) Recombinant Protein now

Add to cart