Brand: | Abnova |
Reference: | P3489 |
Product name: | PRDX5 (Human) Recombinant Protein |
Product description: | Human PRDX5 (NP_036226, 53 a.a. - 214 a.a.) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 25824 |
Gene name: | PRDX5 |
Gene alias: | ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10 |
Gene description: | peroxiredoxin 5 |
Immunogen sequence/protein sequence: | MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
Protein accession: | NP_036226 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM HEPES, pH 7.4 |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: |  |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |