VEGFA (Human) Recombinant Protein View larger

VEGFA (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VEGFA (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about VEGFA (Human) Recombinant Protein

Brand: Abnova
Reference: P3483
Product name: VEGFA (Human) Recombinant Protein
Product description: Human VEGFA (NP_001020541, 207 a.a. - 327 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 7422
Gene name: VEGFA
Gene alias: MGC70609|VEGF|VEGF-A|VPF
Gene description: vascular endothelial growth factor A
Immunogen sequence/protein sequence: MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Protein accession: NP_001020541
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, pH 8.0 (10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3483-1.jpg
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy VEGFA (Human) Recombinant Protein now

Add to cart