Brand: | Abnova |
Reference: | P3477 |
Product name: | IL4 (Human) Recombinant Protein |
Product description: | Human IL4 (NP000580, 25 a.a. - 153 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 3565 |
Gene name: | IL4 |
Gene alias: | BCGF-1|BCGF1|BSF1|IL-4|MGC79402 |
Gene description: | interleukin 4 |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Protein accession: | NP000580 |
Form: | Liquid |
Concentration: | 0.5 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (10% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: |  |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |