Brand: | Abnova |
Reference: | P3471 |
Product name: | VEGFA (Human) Recombinant Protein |
Product description: | Human VEGFA (NP_001020541, 207 a.a. - 327 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 7422 |
Gene name: | VEGFA |
Gene alias: | MGC70609|VEGF|VEGF-A|VPF |
Gene description: | vascular endothelial growth factor A |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR |
Protein accession: | NP_001020541 |
Form: | Liquid |
Concentration: | 0.5 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris, pH 8.0 (10% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![qc_test-P3471-1.jpg](http://www.abnova.com/qc_test_image/qc_test-P3471-1.jpg) |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |